PQ web form

PQ reduced web form

Example of fasta format

>SORMK
SKTRKHRGHVSAGKGGRGMAGGQHHHRTNLDKYHPGYFGKVGMRHFHLLRNHQWAPTLNI
EKLWTLVPAEAREKYVSGAAT-ETAPVIDLLSHGYAKLLGKGRLPAVPIVVRARYVSAEA
ERKVKEAGGVIELV
>GROCL
GRVGKHRKH----PGGRGMAGGMHHHRTNLDKYHPGYFGKVGMRRFHLLRNHQWNPVINL
DKLWTLVPAEVREKYLSGEKK-DTAPVIDLLPFGYSKLLGKGRLPEIPLVVRARYVSKLA
ERKLKEAGAVVELV
>FUSOF
GRVGKHRKH----PGGRGLAGGQHHHRTNMDKYHPGYFGKVGMRYFHKQPNHFWKPIINL
DKLWSLVPQETRDAYVSGEKK-DTVPVLDLLPLGYSKVLGKGRLPEIPLVVRARWVSRLA
EQKIKQAGGVVELV
>LODEL
GRVGKHRKH----PGGRGKAGGQHHHRTNLDKYHPGYFGKVGMRYFHKQQNHFWRPEINL
DKLWTLVESDKKDEYLKTASA-SAAPVIDTLAAGYGKVLGKGRLPQVPVIVKARFVSKLA
EEKIRAVGGVVELV
>EMENI
GRIGKHRKH----PGGRGMAGGQHHHRTNLDKYHPGYFGKVGMRYFHKTQQQFWKPTINV
DKLWSLVPAEQRDAYISGQKT-DTAPVIDLLSLGYSKVLGKGRLPEVPIVVRARYVSRDA
EQKIKEAGGVVELV
>CANGA
GRIGKHRKH----PGGRGMAGGQHHHRTNLDKYHPGYFGKVGMRYFHKQQNHFWRPVLNL
DKLWTLIPEDKRDEYLKSSSK-SAAPVIDTLAAGYGKVLGKGRIPNVPVIVKARFVSKLA
EEKIKAAGGVVELI
>HYPVG
GRVGKHRKH----PGGRGLAGGQHHHRTNMDKYHPGYFGKVGMRYFHKQQNHFWKPIINL
DKLWSLVPVETREAYVSGEKK-DTVPVLDLLPLGYSKLLGKGRIPEIPLVVRARWVSKLA
EEKIKKAGGVIELV
>CANDC
GRIGKHRKH----PGGRGKAGGQHHHRTNLDKYHPGYFGKVGMRYFHKQQNHFWRPEINL
DKLWTLVDSEKKDEYLSKSSA-SAAPVIDTLAHGYGKVLGKGRLPEVPVIVKARFVSKLA
EEKIRAVGGVVELV
>TORDC
GRIGKHRKH----PGGRGMAGGQHHHRTNLDKYHPGYFGKVGMRYFHQQKAHFWKPVLNL
DKLWSLVPETKRDEYLQSSSK-SAAPVIDTLAAGYGKVLGKGRIPNVPVIVKARFVSKLA
EEKIRAAGGVVELI
>COCP7
GRIGKHRKH----PGGRGMAGGQHHHRTNLDKYHPGYFGKVGMRYFHKTMNQFWKPTINL
DKLWSLVPAETREAYVSNQKP-DTAPVLDLLSLGYSKVLGKGRLPEVPMVVRARYVSKEA
ERKIKEAGGVVELV
>TALSN
GRIGKHRKH----PGGRGMAGGQHHHRTNLDKYHPGYFGKVGMRHFHLQRNHYWKPTINL
DKLWSLVPEETREKYVAGNAPSDKAIVLDLLSLGYAKVLGKGRLPEVPIVVKARYVSKEA
ERKIKEAGGVIELV